PHF1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8450
- Bilder (1)
| Artikelname: | PHF1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8450 |
| Hersteller Artikelnummer: | A8450 |
| Alternativnummer: | ABB-A8450-20UL,ABB-A8450-100UL,ABB-A8450-1000UL,ABB-A8450-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PCL1, PHF2, hPHF1, MTF2L2, TDRD19C, PHF1 |
| This gene encodes a Polycomb group protein. The protein is a component of a histone H3 lysine-27 (H3K27)-specific methyltransferase complex, and functions in transcriptional repression of homeotic genes. The protein is also recruited to double-strand breaks, and reduced protein levels results in X-ray sensitivity and increased homologous recombination. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 62kDa |
| NCBI: | 5252 |
| UniProt: | O43189 |
| Reinheit: | Affinity purification |
| Sequenz: | MAQPPRLSRSGASSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPGEELLCCVCRSETVVPGNRLVSCEKCRHAYHQDCHVPRAPAPGEGEGTSWVCRQCVFAIATKRGGALKKGPYARAMLGMKLSLPYGLKGLDWDAGHLSNRQQSYCYCGGPGEWNLKMLQCRSCLQWFHEACTQCLSKPLLYGDRFYEFECCVCRGGPEKVRRLQLRWVDVA |
| Target-Kategorie: | PHF1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Chromatin Remodeling. Shipping: Ice Bag |

