TADA2A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8457
- Bilder (1)
| Artikelname: | TADA2A Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8457 |
| Hersteller Artikelnummer: | A8457 |
| Alternativnummer: | ABB-A8457-100UL,ABB-A8457-20UL,ABB-A8457-500UL,ABB-A8457-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ADA2, ADA2A, KL04P, hADA2, TADA2L, TADA2A |
| Many DNA-binding transcriptional activator proteins enhance the initiation rate of RNA polymerase II-mediated gene transcription by interacting functionally with the general transcription machinery bound at the basal promoter. Adaptor proteins are usually required for this activation, possibly to acetylate and destabilize nucleosomes, thereby relieving chromatin constraints at the promoter. The protein encoded by this gene is a transcriptional activator adaptor and has been found to be part of the PCAF histone acetylase complex. Several alternatively spliced transcript variants encoding different isoforms of this gene have been described, but the full-length nature of some of these variants has not been determined. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 52kDa |
| NCBI: | 6871 |
| UniProt: | O75478 |
| Reinheit: | Affinity purification |
| Sequenz: | MDRLGSFSNDPSDKPPCRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGFEYKKHQSDHTYEIMTSDFPVLDPSWTAQEEMALLEAVMDCGFGNWQDVANQMCTKTKEECEKHYMKHFINNPLFASTLLNLKQAEEAKTADTAIPFHSTDDPPRPTFDSLLSRDMAGYMPARADFIEEFDNYAEWDLRDIDFVEDDSDILHALKMAVVDIYHSRLKERQRRKKIIRDHGLINLRKFQLMERRYPKEVQDLYETMR |
| Target-Kategorie: | TADA2A |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Apoptosis. Shipping: Ice Bag |

