INADL Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8476
- Bilder (1)
| Artikelname: | INADL Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8476 |
| Hersteller Artikelnummer: | A8476 |
| Alternativnummer: | ABB-A8476-20UL,ABB-A8476-100UL,ABB-A8476-500UL,ABB-A8476-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Synthetic peptide. This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | Cipp, INADL, hINADL, InaD-like |
| This gene encodes a protein with multiple PDZ domains. PDZ domains mediate protein-protein interactions, and proteins with multiple PDZ domains often organize multimeric complexes at the plasma membrane. This protein localizes to tight junctions and to the apical membrane of epithelial cells. A similar protein in Drosophila is a scaffolding protein which tethers several members of a multimeric signaling complex in photoreceptors. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 196kDa |
| NCBI: | 10207 |
| UniProt: | Q8NI35 |
| Reinheit: | Affinity purification |
| Sequenz: | VRRKTSSSTSPLEPPSDRGTVVEPLKPPALFLTGAVETETNVDGEDEEIKERIDTLKNDNIQALEKLEKVPDSPENELKSRWENLLGPDYEVMVATLDTQIADDAELQKYSKLLPIHTLRLGVEVDSFDGHHYISSIVSGGPVDTLGLLQPEDELLEVNGMQLYGKSRREAVSFLKEVPPPFTLVCCRRLFDDEASVDEPRRTETSLPETEVDHNMDVNTEEDDDGELALW |
| Target-Kategorie: | PATJ |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Tight Junctions,Cytoskeleton,Neuroscience. Shipping: Ice Bag |

