INADL Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A8476
Artikelname: INADL Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A8476
Hersteller Artikelnummer: A8476
Alternativnummer: ABB-A8476-20UL,ABB-A8476-100UL,ABB-A8476-500UL,ABB-A8476-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: Cipp, INADL, hINADL, InaD-like
This gene encodes a protein with multiple PDZ domains. PDZ domains mediate protein-protein interactions, and proteins with multiple PDZ domains often organize multimeric complexes at the plasma membrane. This protein localizes to tight junctions and to the apical membrane of epithelial cells. A similar protein in Drosophila is a scaffolding protein which tethers several members of a multimeric signaling complex in photoreceptors.
Klonalität: Polyclonal
Molekulargewicht: 196kDa
NCBI: 10207
UniProt: Q8NI35
Reinheit: Affinity purification
Sequenz: VRRKTSSSTSPLEPPSDRGTVVEPLKPPALFLTGAVETETNVDGEDEEIKERIDTLKNDNIQALEKLEKVPDSPENELKSRWENLLGPDYEVMVATLDTQIADDAELQKYSKLLPIHTLRLGVEVDSFDGHHYISSIVSGGPVDTLGLLQPEDELLEVNGMQLYGKSRREAVSFLKEVPPPFTLVCCRRLFDDEASVDEPRRTETSLPETEVDHNMDVNTEEDDDGELALW
Target-Kategorie: PATJ
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Tight Junctions,Cytoskeleton,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using INADL Rabbit pAb (A8476) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.