CDC42EP3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8480
- Bilder (1)
| Artikelname: | CDC42EP3 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8480 |
| Hersteller Artikelnummer: | A8480 |
| Alternativnummer: | ABB-A8480-20UL,ABB-A8480-100UL,ABB-A8480-500UL,ABB-A8480-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | UB1, CEP3, BORG2, CDC42EP3 |
| This gene encodes a member of a small family of guanosine triphosphate (GTP) metabolizing proteins that contain a CRIB (Cdc42, Rac interactive binding) domain. Members of this family of proteins act as effectors of CDC42 function. The encoded protein is involved in actin cytoskeleton re-organization during cell shape changes, including pseudopodia formation. A pseudogene of this gene is found on chromosome 19. Alternative splicing results in multiple transcript variants. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 28kDa |
| NCBI: | 10602 |
| UniProt: | Q9UKI2 |
| Reinheit: | Affinity purification |
| Sequenz: | MPAKTPIYLKAANNKKGKKFKLRDILSPDMISPPLGDFRHTIHIGKEGQHDVFGDISFLQGNYELLPGNQEKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNAISLPTIGGSQALMLPLLSPVTFNSKQESFGPAKLPRLSCEPVMEEKAQEKSSLLENGTVHQGDTSWGSSGSASQSSQGRDSHSSSLSEQYPDWPAEDMFDHPTPCELIKGKTKSEESLSDLTGSLLSLQLDLGPSLLDEVLNVMDKNK |
| Target-Kategorie: | CDC42EP3 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,Small G proteins,Cell Biology Developmental Biology,Cytoskeleton,Microfilaments,Immunology Inflammation,NF-kB Signaling Pathway,Toll-like Receptor Signaling Pathway. Shipping: Ice Bag |

