SYNPO Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8484
- Bilder (1)
| Artikelname: | SYNPO Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8484 |
| Hersteller Artikelnummer: | A8484 |
| Alternativnummer: | ABB-A8484-20UL,ABB-A8484-100UL,ABB-A8484-500UL,ABB-A8484-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | SYNPO |
| Synaptopodin is an actin-associated protein that may play a role in actin-based cell shape and motility. The name synaptopodin derives from the proteins associations with postsynaptic densities and dendritic spines and with renal podocytes (Mundel et al., 1997 [PubMed 9314539]). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 99kDa |
| NCBI: | 11346 |
| UniProt: | Q8N3V7 |
| Reinheit: | Affinity purification |
| Sequenz: | MLGPHLPPPPLAPSEGRPTPCAFQIPDGSYRCLALEAEESSGEEGLQGEVGPTDLEEDEGVSRSGDDSACRVTQGTPQLPKALGIQPPSCSREEQGASQHDDRASQDWDVVKAGQMMTASPSPGPGPRVAQKPALGRSTSLTEKDLKEAKARSQQIAAQLTTPPSSNSRGVQLFNRRRQRVNEFTLESHGQRGQKPSQESLRVLPSSLPGHAPGLSLSSTSLPEPGPPRHPSPQSPDRGVPGHSMEGYSEEASLL |
| Target-Kategorie: | SYNPO |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Cell Adhesion,Neuroscience, Cell Type Marker,Neuron marker,Synapse marker. Shipping: Ice Bag |

