SYNPO Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A8484
Artikelname: SYNPO Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A8484
Hersteller Artikelnummer: A8484
Alternativnummer: ABB-A8484-20UL,ABB-A8484-100UL,ABB-A8484-500UL,ABB-A8484-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: SYNPO
Synaptopodin is an actin-associated protein that may play a role in actin-based cell shape and motility. The name synaptopodin derives from the proteins associations with postsynaptic densities and dendritic spines and with renal podocytes (Mundel et al., 1997 [PubMed 9314539]).
Klonalität: Polyclonal
Molekulargewicht: 99kDa
NCBI: 11346
UniProt: Q8N3V7
Reinheit: Affinity purification
Sequenz: MLGPHLPPPPLAPSEGRPTPCAFQIPDGSYRCLALEAEESSGEEGLQGEVGPTDLEEDEGVSRSGDDSACRVTQGTPQLPKALGIQPPSCSREEQGASQHDDRASQDWDVVKAGQMMTASPSPGPGPRVAQKPALGRSTSLTEKDLKEAKARSQQIAAQLTTPPSSNSRGVQLFNRRRQRVNEFTLESHGQRGQKPSQESLRVLPSSLPGHAPGLSLSSTSLPEPGPPRHPSPQSPDRGVPGHSMEGYSEEASLL
Target-Kategorie: SYNPO
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Cell Adhesion,Neuroscience, Cell Type Marker,Neuron marker,Synapse marker. Shipping: Ice Bag
Western blot analysis of various lysates using SYNPO Rabbit pAb (A8484) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.