KDM4C Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A8485
Artikelname: KDM4C Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A8485
Hersteller Artikelnummer: A8485
Alternativnummer: ABB-A8485-100UL,ABB-A8485-20UL,ABB-A8485-500UL,ABB-A8485-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: GASC1, JHDM3C, JMJD2C, TDRD14C, KDM4C
This gene is a member of the Jumonji domain 2 (JMJD2) family. The encoded protein is a trimethylation-specific demethylase, and converts specific trimethylated histone residues to the dimethylated form. This enzymatic action regulates gene expression and chromosome segregation. Chromosomal aberrations and changes in expression of this gene may be found in tumor cells. Alternative splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 120kDa
NCBI: 23081
UniProt: Q9H3R0
Reinheit: Affinity purification
Sequenz: RMKPHCAICTLLMPYHKPDSSNEENDARWETKLDEVVTSEGKTKPLIPEMCFIYSEENIEYSPPNAFLEEDGTSLLISCAKCCVRVHASCYGIPSHEICDGWLCARCKRNAWTAECCLCNLRGGALKQTKNNKWAHVMCAVAVPEVRFTNVPERTQIDVGRIPLQRLKLKCIFCRHRVKRVSGACIQCSYG
Target-Kategorie: KDM4C
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones. Shipping: Ice Bag
Western blot analysis of lysates from Mouse brain, using KDM4C Rabbit pAb (A8485) at 1:800 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.