KDM4C Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8485
- Bilder (1)
| Artikelname: | KDM4C Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8485 |
| Hersteller Artikelnummer: | A8485 |
| Alternativnummer: | ABB-A8485-100UL,ABB-A8485-20UL,ABB-A8485-500UL,ABB-A8485-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GASC1, JHDM3C, JMJD2C, TDRD14C, KDM4C |
| This gene is a member of the Jumonji domain 2 (JMJD2) family. The encoded protein is a trimethylation-specific demethylase, and converts specific trimethylated histone residues to the dimethylated form. This enzymatic action regulates gene expression and chromosome segregation. Chromosomal aberrations and changes in expression of this gene may be found in tumor cells. Alternative splicing results in multiple transcript variants. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 120kDa |
| NCBI: | 23081 |
| UniProt: | Q9H3R0 |
| Reinheit: | Affinity purification |
| Sequenz: | RMKPHCAICTLLMPYHKPDSSNEENDARWETKLDEVVTSEGKTKPLIPEMCFIYSEENIEYSPPNAFLEEDGTSLLISCAKCCVRVHASCYGIPSHEICDGWLCARCKRNAWTAECCLCNLRGGALKQTKNNKWAHVMCAVAVPEVRFTNVPERTQIDVGRIPLQRLKLKCIFCRHRVKRVSGACIQCSYG |
| Target-Kategorie: | KDM4C |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones. Shipping: Ice Bag |

