CEP83 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8491
- Bilder (1)
| Artikelname: | CEP83 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8491 |
| Hersteller Artikelnummer: | A8491 |
| Alternativnummer: | ABB-A8491-20UL,ABB-A8491-100UL,ABB-A8491-500UL,ABB-A8491-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CCDC41, NPHP18, NY-REN-58, CEP83 |
| The protein encoded by this gene is a centriolar protein involved in primary cilium assembly. Defects in this gene have been associated with infantile nephronophthisis and intellectual disability. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 83kDa |
| NCBI: | 51134 |
| UniProt: | Q9Y592 |
| Reinheit: | Affinity purification |
| Sequenz: | MLIDERLRCEHHKANYQTLKAEHTRLQNEHVKLQNELKHLFNEKQTQQEKLQLLLEELRGELVEKTKDLEEMKLQILTPQKLELLRAQIQQELETPMRERFRNLDEEVEKYRAVYNKLRYEHTFLKSEFEHQKEEYARILDEGKIKYESEIARLEEDKEELRNQLLNVDLTKDSKRVEQLAREKVYLCQKLKGLEAEVAELKAEKENSEAQVENAQRIQVRQLAEMQ |
| Target-Kategorie: | CEP83 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology,Cell Cycle,Centrosome. Shipping: Ice Bag |

