MTERFD3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8518
- Bilder (1)
| Artikelname: | MTERFD3 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8518 |
| Hersteller Artikelnummer: | A8518 |
| Alternativnummer: | ABB-A8518-20UL,ABB-A8518-100UL,ABB-A8518-1000UL,ABB-A8518-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | mTERFL, MTERFD3 |
| Enables DNA binding activity. Predicted to be involved in termination of mitochondrial transcription. Located in mitochondrion. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 44kDa |
| NCBI: | 80298 |
| UniProt: | Q49AM1 |
| Reinheit: | Affinity purification |
| Sequenz: | MLWKLLLRSQSCRLCSFRKMRSPPKYRPFLACFTYTTDKQSSKENTRTVEKLYKCSVDIRKIRRLKGWVLLEDETYVEEIANILQELGADETAVASILERCPEAIVCSPTAVNTQRKLWQLVCKNEEELIKLIEQFPESFFTIKDQENQKLNVQFFQELGLKNVVISRLLTAAPNVFHNPVEKNKQMVRILQESYLDVGGSEANMKVWLLKLLSQNPFILLNSPTAIKETLEFLQEQGFTSFEILQLLSK |
| Target-Kategorie: | MTERF2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Endocrine Metabolism,Mitochondrial metabolism. Shipping: Ice Bag |

