MTIF3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8524
- Bilder (1)
| Artikelname: | MTIF3 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8524 |
| Hersteller Artikelnummer: | A8524 |
| Alternativnummer: | ABB-A8524-20UL,ABB-A8524-100UL,ABB-A8524-500UL,ABB-A8524-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | IF3mt, MTIF3 |
| This gene encodes a translation initiation factor that is involved in mitochondrial protein synthesis. Polymorphism in this gene is associated with the onset of Parkinsons disease. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 5. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 32kDa |
| NCBI: | 219402 |
| UniProt: | Q9H2K0 |
| Reinheit: | Affinity purification |
| Sequenz: | MAALFLKRLTLQTVKSENSCIRCFGKHILQKTAPAQLSPIASAPRLSFLIHAKAFSTAEDTQNEGKKTKKNKTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRNTSTEPAEYQLMTGLQILQERQRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQQWIKKKHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVLRAFSKNEEKAYKETQ |
| Target-Kategorie: | MTIF3 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Rat. ResearchArea: Epigenetics Nuclear Signaling,Endocrine Metabolism,Mitochondrial metabolism,Neuroscience,Neurodegenerative Diseases,Dopamine Signaling in Parkinsons Disease. Shipping: Ice Bag |

