MSH4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8556
- Bilder (1)
| Artikelname: | MSH4 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8556 |
| Hersteller Artikelnummer: | A8556 |
| Alternativnummer: | ABB-A8556-100UL,ABB-A8556-20UL,ABB-A8556-1000UL,ABB-A8556-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ASG, POF20, SPGF2, MSH4 |
| This gene encodes a member of the DNA mismatch repair mutS family. This member is a meiosis-specific protein that is not involved in DNA mismatch correction, but is required for reciprocal recombination and proper segregation of homologous chromosomes at meiosis I. This protein and MSH5 form a heterodimer which binds uniquely to a Holliday Junction and its developmental progenitor, thus provoking ADP-ATP exchange, and stabilizing the interaction between parental chromosomes during meiosis double-stranded break repair. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 105kDa |
| NCBI: | 4438 |
| UniProt: | O15457 |
| Reinheit: | Affinity purification |
| Sequenz: | QIMAQIGSYVPAEYSSFRIAKQIFTRISTDDDIETNSSTFMKEMKEIAYILHNANDKSLILIDELGRGTNTEEGIGICYAVCEYLLSLKAFTLFATHFLELCHIDALYPNVENMHFEVQHVKNTSRNKEAILYTYKLSKGLTEEKNYGLKAAEVSSLPPSIVLDAKEITTQITRQILQNQRSTPEMERQRAVYHLATRLVQTARNSQLDPDSLRIYLSNLKKKYKEDFPRTEQVPEKTEE |
| Target-Kategorie: | MSH4 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair. Shipping: Ice Bag |

