GATC Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8604
- Bilder (1)
| Artikelname: | GATC Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8604 |
| Hersteller Artikelnummer: | A8604 |
| Alternativnummer: | ABB-A8604-20UL,ABB-A8604-100UL,ABB-A8604-500UL,ABB-A8604-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | 15E1.2, COXPD42, GATC |
| Enables glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity. Involved in glutaminyl-tRNAGln biosynthesis via transamidation and mitochondrial translation. Located in mitochondrion. Part of glutamyl-tRNA(Gln) amidotransferase complex. Implicated in combined oxidative phosphorylation deficiency 42. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 15kDa |
| NCBI: | 283459 |
| UniProt: | O43716 |
| Reinheit: | Affinity purification |
| Sequenz: | MWSRLVWLGLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLEKAIAFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVEGNCADELLQNSHRVVEEYFVAPPGNISLPKLDEQEPFPHS |
| Target-Kategorie: | GATC |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse,Rat. ResearchArea: Endocrine Metabolism,Mitochondrial metabolism. Shipping: Ice Bag |

