KCNK9 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A8609
Artikelname: KCNK9 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A8609
Hersteller Artikelnummer: A8609
Alternativnummer: ABB-A8609-100UL,ABB-A8609-20UL,ABB-A8609-500UL,ABB-A8609-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: KT3.2, TASK3, BIBARS, K2p9.1, TASK-3, TASK32, KCNK9
This gene encodes a protein that contains multiple transmembrane regions and two pore-forming P domains and functions as a pH-dependent potassium channel. Amplification and overexpression of this gene have been observed in several types of human carcinomas. This gene is imprinted in the brain, with preferential expression from the maternal allele. A mutation in this gene was associated with Birk-Barel dysmorphism syndrome. Alternative splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 51305
UniProt: Q9NPC2
Reinheit: Affinity purification
Sequenz: MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAA
Target-Kategorie: KCNK9
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using KCNK9 Rabbit pAb (A8609) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 15s.