PFDN1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A8681
Artikelname: PFDN1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A8681
Hersteller Artikelnummer: A8681
Alternativnummer: ABB-A8681-20UL,ABB-A8681-100UL,ABB-A8681-1000UL,ABB-A8681-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: PDF, PFD1, PFDN1
This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils.
Klonalität: Polyclonal
Molekulargewicht: 14kDa
NCBI: 5201
UniProt: O60925
Reinheit: Affinity purification
Sequenz: MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ
Target-Kategorie: PFDN1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Signal Transduction. Shipping: Ice Bag
Western blot analysis of various lysates using PFDN1 Rabbit pAb (A8681) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.