IGHA1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A8708
Artikelname: IGHA1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A8708
Hersteller Artikelnummer: A8708
Alternativnummer: ABB-A8708-20UL,ABB-A8708-100UL,ABB-A8708-1000UL,ABB-A8708-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, FC, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: IgA1, IGHA1
Contributes to immunoglobulin receptor binding activity. Involved in antibacterial humoral response, glomerular filtration, and positive regulation of respiratory burst. Located in extracellular space. Part of monomeric IgA immunoglobulin complex and secretory dimeric IgA immunoglobulin complex.
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 3493
UniProt: P01876
Reinheit: Affinity purification
Sequenz: CCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLADWQMPPPYVVLDLPQETLEE
Target-Kategorie: IGHA1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|FC,1:20 - 1:50|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. Shipping: Ice Bag
Western blot analysis of lysates from SH-SY5Y cells, using IGHA1 Rabbit pAb (A8708) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.