IGHA1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8708
- Bilder (1)
| Artikelname: | IGHA1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8708 |
| Hersteller Artikelnummer: | A8708 |
| Alternativnummer: | ABB-A8708-20UL,ABB-A8708-100UL,ABB-A8708-1000UL,ABB-A8708-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, FC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Synthetic peptide. This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | IgA1, IGHA1 |
| Contributes to immunoglobulin receptor binding activity. Involved in antibacterial humoral response, glomerular filtration, and positive regulation of respiratory burst. Located in extracellular space. Part of monomeric IgA immunoglobulin complex and secretory dimeric IgA immunoglobulin complex. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 38kDa |
| NCBI: | 3493 |
| UniProt: | P01876 |
| Reinheit: | Affinity purification |
| Sequenz: | CCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLADWQMPPPYVVLDLPQETLEE |
| Target-Kategorie: | IGHA1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|FC,1:20 - 1:50|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. Shipping: Ice Bag |

