TRIM44 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A8719
Artikelname: TRIM44 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A8719
Hersteller Artikelnummer: A8719
Alternativnummer: ABB-A8719-20UL,ABB-A8719-100UL,ABB-A8719-500UL,ABB-A8719-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: AN3, MC7, DIPB, HSA249128, TRIM44
This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, namely a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region.
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 54765
UniProt: Q96DX7
Reinheit: Affinity purification
Sequenz: GAHQGHQLSTLDEAFEELRSKDSGGLKAAMIELVERLKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQSHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGASEEEDT
Target-Kategorie: TRIM44
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using TRIM44 Rabbit pAb (A8719) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.