TRIM44 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8719
- Bilder (1)
| Artikelname: | TRIM44 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8719 |
| Hersteller Artikelnummer: | A8719 |
| Alternativnummer: | ABB-A8719-20UL,ABB-A8719-100UL,ABB-A8719-500UL,ABB-A8719-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | AN3, MC7, DIPB, HSA249128, TRIM44 |
| This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, namely a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 38kDa |
| NCBI: | 54765 |
| UniProt: | Q96DX7 |
| Reinheit: | Affinity purification |
| Sequenz: | GAHQGHQLSTLDEAFEELRSKDSGGLKAAMIELVERLKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQSHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGASEEEDT |
| Target-Kategorie: | TRIM44 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag |

