MTMR2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8993
- Bilder (1)
| Artikelname: | MTMR2 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8993 |
| Hersteller Artikelnummer: | A8993 |
| Alternativnummer: | ABB-A8993-20UL,ABB-A8993-100UL,ABB-A8993-1000UL,ABB-A8993-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CMT4B, CMT4B1, MTMR2 |
| This gene is a member of the myotubularin family of phosphoinositide lipid phosphatases. The encoded protein possesses phosphatase activity towards phosphatidylinositol-3-phosphate and phosphatidylinositol-3,5-bisphosphate. Mutations in this gene are a cause of Charcot-Marie-Tooth disease type 4B, an autosomal recessive demyelinating neuropathy. Alternatively spliced transcript variants encoding multiple isoforms have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 73kDa |
| NCBI: | 8898 |
| UniProt: | Q13614 |
| Reinheit: | Affinity purification |
| Sequenz: | DKVESGKTSVVVHCSDGWDRTAQLTSLAMLMLDGYYRTIRGFEVLVEKEWLSFGHRFQLRVGHGDKNHADADRSPVFLQFIDCVWQMTRQFPTAFEFNEYFLITILDHLYSCLFGTFLCNSEQQRGKENLPKRTVSLWSYINSQLEDFTNPLYGSYSNHVLYPVASMRHLELWVGYYIRWNPRMKPQEPIHNRYKELLAKRAELQKKVEELQREISNRSTSSSERASSPAQCVTPVQTVV |
| Target-Kategorie: | MTMR2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag |

