APOBEC3B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A9010
Artikelname: APOBEC3B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A9010
Hersteller Artikelnummer: A9010
Alternativnummer: ABB-A9010-20UL,ABB-A9010-100UL,ABB-A9010-500UL,ABB-A9010-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: A3B, ARP4, ARCD3, PHRBNL, APOBEC1L, bK150C2.2, DJ742C19.2, APOBEC3B
This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. A hybrid gene results from the deletion of approximately 29.5 kb of sequence between this gene, APOBEC3B, and the adjacent gene APOBEC3A. The breakpoints of the deletion are within the two genes, so the deletion allele is predicted to have the promoter and coding region of APOBEC3A, but the 3 UTR of APOBEC3B. Two transcript variants encoding different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 46kDa
NCBI: 9582
UniProt: Q9UH17
Reinheit: Affinity purification
Sequenz: EEFAYCWENFVYNEGQQFMPWYKFDENYAFLHRTLKEILRYLMDPDTFTFNFNNDPLVLRRRQTYLCYEVERLDNGTWVLMDQHMGFLCNEAKNLLCGFY
Target-Kategorie: APOBEC3B
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:200 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Immunology Inflammation. Shipping: Ice Bag
Western blot analysis of various lysates, using APOBEC3B Rabbit pAb (A9010) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.