MYO18A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A9015
Artikelname: MYO18A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A9015
Hersteller Artikelnummer: A9015
Alternativnummer: ABB-A9015-100UL,ABB-A9015-20UL,ABB-A9015-500UL,ABB-A9015-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: MAJN, TIAF1, MYSPDZ, SPR210, SP-R210, MYO18A
The protein encoded by this gene can bind GOLPH3, linking the Golgi to the cytoskeleton and influencing Golgi membrane trafficking. The encoded protein is also part of a complex that assembles lamellar actomyosin bundles and may be required for cell migration.
Klonalität: Polyclonal
Molekulargewicht: 233kDa
NCBI: 399687
UniProt: Q92614
Reinheit: Affinity purification
Sequenz: SDVDSELEDRVDGVKSWLSKNKGPSKAASDDGSLKSSSPTSYWKSLAPDRSDDEHDPLDNTSRPRYSHSYLSDSDTEAKLTETNA
Target-Kategorie: MYO18A
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cytoskeleton,Motor Proteins. Shipping: Ice Bag
Western blot analysis of various lysates using MYO18A Rabbit pAb (A9015) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.