MED4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A9150
Artikelname: MED4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A9150
Hersteller Artikelnummer: A9150
Alternativnummer: ABB-A9150-100UL,ABB-A9150-20UL,ABB-A9150-1000UL,ABB-A9150-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ARC36, VDRIP, DRIP36, TRAP36, HSPC126, MED4
This gene encodes a component of the Mediator complex. The Mediator complex interacts with DNA-binding gene-specific transcription factors to modulate transcription by RNA polymerase II. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Klonalität: Polyclonal
Molekulargewicht: 30kDa
NCBI: 29079
UniProt: Q9NPJ6
Reinheit: Affinity purification
Sequenz: MAASSSGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKENEDDV
Target-Kategorie: MED4
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using MED4 Rabbit pAb (A9150) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.