RPL26L1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A9192
- Bilder (1)
| Artikelname: | RPL26L1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A9192 |
| Hersteller Artikelnummer: | A9192 |
| Alternativnummer: | ABB-A9192-20UL,ABB-A9192-100UL,ABB-A9192-1000UL,ABB-A9192-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | RPL26P1, RPL26L1 |
| This gene encodes a protein that shares high sequence similarity with ribosomal protein L26. Alternative splicing results in multiple transcript variants encoding the same protein. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 17kDa |
| NCBI: | 51121 |
| UniProt: | Q9UNX3 |
| Reinheit: | Affinity purification |
| Sequenz: | MKFNPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEELIEKMQE |
| Target-Kategorie: | RPL26L1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology. Shipping: Ice Bag |

