RPL26L1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A9192
Artikelname: RPL26L1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A9192
Hersteller Artikelnummer: A9192
Alternativnummer: ABB-A9192-20UL,ABB-A9192-100UL,ABB-A9192-1000UL,ABB-A9192-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: RPL26P1, RPL26L1
This gene encodes a protein that shares high sequence similarity with ribosomal protein L26. Alternative splicing results in multiple transcript variants encoding the same protein.
Klonalität: Polyclonal
Molekulargewicht: 17kDa
NCBI: 51121
UniProt: Q9UNX3
Reinheit: Affinity purification
Sequenz: MKFNPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEELIEKMQE
Target-Kategorie: RPL26L1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology. Shipping: Ice Bag
Western blot analysis of various lysates using RPL26L1 Rabbit pAb (A9192) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.