NPL Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A9210
- Bilder (1)
| Artikelname: | NPL Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A9210 |
| Hersteller Artikelnummer: | A9210 |
| Alternativnummer: | ABB-A9210-20UL,ABB-A9210-100UL,ABB-A9210-500UL,ABB-A9210-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | NAL, C112, NPL1, C1orf13, NPL |
| This gene encodes a member of the N-acetylneuraminate lyase sub-family of (beta/alpha)(8)-barrel enzymes. N-acetylneuraminate lyases regulate cellular concentrations of N-acetyl-neuraminic acid (sialic acid) by mediating the reversible conversion of sialic acid into N-acetylmannosamine and pyruvate. A pseudogene of this gene is located on the short arm of chromosome 2. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 35kDa |
| NCBI: | 80896 |
| UniProt: | Q9BXD5 |
| Reinheit: | Affinity purification |
| Sequenz: | MAFPKKKLQGLVAATITPMTENGEINFSVIGQYVDYLVKEQGVKNIFVNGTTGEGLSLSVSERRQVAEEWVTKGKDKLDQVIIHVGALSLKESQELAQHAAEIGADGIAVIAPFFLKPWTKDILINFLKEVAAAAPALPFYYYHIPALTGVKIRAEELLDGILDKIPTFQGLKFSDTDLLDFGQCVDQNRQQQFAFLFGVDEQLLSALVMGATGAVGSTYNYLGKKTNQMLEAFEQKDFSLALNYQFCIQ |
| Target-Kategorie: | NPL |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction,Endocrine Metabolism. Shipping: Ice Bag |

