RAB11FIP1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A9215
- Bilder (1)
| Artikelname: | RAB11FIP1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A9215 |
| Hersteller Artikelnummer: | A9215 |
| Alternativnummer: | ABB-A9215-100UL,ABB-A9215-20UL,ABB-A9215-1000UL,ABB-A9215-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | RCP, NOEL1A, rab11-FIP1, RAB11FIP1 |
| This gene encodes one of the Rab11-family interacting proteins (Rab11-FIPs), which play a role in the Rab-11 mediated recycling of vesicles. The encoded protein may be involved in endocytic sorting, trafficking of proteins including integrin subunits and epidermal growth factor receptor (EGFR), and transport between the recycling endosome and the trans-Golgi network. Alternative splicing results in multiple transcript variants. A pseudogene is described on the X chromosome. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 137kDa |
| NCBI: | 80223 |
| UniProt: | Q6WKZ4 |
| Reinheit: | Affinity purification |
| Sequenz: | EAKGEIKDSSPSSSPSPKGFRKKHLFSSTENLAAGSWKEPAEGGGLSSDRQLSESSTKDSLKSMTLPSYRPAPLVSGDLRENMAPANSEATKEAKESKKPESRRSSLLSLMTGKKDVAKGSEGENPLTVPGREKEGMLMGVKPGEDASGPAEDLVRRSEKDTAAVVSRQGSSLNLFEDVQITEPEAEPESKSEPRPPISSPRAPQTRAVKP |
| Target-Kategorie: | RAB11FIP1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Signal Transduction,G protein signaling,Small G proteins. Shipping: Ice Bag |

