LINGO1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A9369
- Bilder (1)
| Artikelname: | LINGO1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A9369 |
| Hersteller Artikelnummer: | A9369 |
| Alternativnummer: | ABB-A9369-100UL,ABB-A9369-20UL,ABB-A9369-1000UL,ABB-A9369-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | LERN1, MRT64, LRRN6A, UNQ201, LINGO1 |
| Predicted to enable epidermal growth factor receptor binding activity. Predicted to act upstream of or within generation of neurons and protein kinase B signaling. Predicted to be located in plasma membrane. Predicted to be active in extracellular matrix and extracellular space. Implicated in autosomal recessive non-syndromic intellectual disability and glaucoma. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 70kDa |
| NCBI: | 84894 |
| UniProt: | Q96FE5 |
| Reinheit: | Affinity purification |
| Sequenz: | CPPRCECSAQDRAVLCHRKRFVAVPEGIPTETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGAFNNLFNLRTLGLRSNRLKLIPLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVGDNDLVYISHRAFSGLNSLEQLTLEKCNLTSIPTEALSHLHGLIVLRLRHLNINAIRDYSFKRLYR |
| Target-Kategorie: | LINGO1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: G protein signaling,G-Protein-Coupled ReceptorsGPCR,Cell Biology Developmental Biology,Neuroscience. Shipping: Ice Bag |

