PYGM Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A9392
Artikelname: PYGM Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A9392
Hersteller Artikelnummer: A9392
Alternativnummer: ABB-A9392-100UL,ABB-A9392-20UL,ABB-A9392-500UL,ABB-A9392-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: GSD5, PYGM
This gene encodes a muscle enzyme involved in glycogenolysis. Highly similar enzymes encoded by different genes are found in liver and brain. Mutations in this gene are associated with McArdle disease (myophosphorylase deficiency), a glycogen storage disease of muscle. Alternative splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 97kDa
NCBI: 5837
UniProt: P11217
Reinheit: Affinity purification
Sequenz: IEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEDYIKCQEKVSALYKNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDEAI
Target-Kategorie: PYGM
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Carbohydrate metabolism,Cardiovascular,Hypoxia,Heart. Shipping: Ice Bag
Western blot analysis of various lysates using PYGM Rabbit pAb (A9392) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.