TNPO1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A9435
Artikelname: TNPO1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A9435
Hersteller Artikelnummer: A9435
Alternativnummer: ABB-A9435-100UL,ABB-A9435-20UL,ABB-A9435-1000UL,ABB-A9435-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: MIP, TRN, IPO2, MIP1, KPNB2, TNPO1
This gene encodes the beta subunit of the karyopherin receptor complex which interacts with nuclear localization signals to target nuclear proteins to the nucleus. The karyopherin receptor complex is a heterodimer of an alpha subunit which recognizes the nuclear localization signal and a beta subunit which docks the complex at nucleoporins. Alternate splicing of this gene results in several transcript variants encoding different proteins.
Klonalität: Polyclonal
Molekulargewicht: 102kDa
NCBI: 3842
UniProt: Q92973
Reinheit: Affinity purification
Sequenz: CPQEVAPMLQQFIRPWCTSLRNIRDNEEKDSAFRGICTMISVNPSGVIQDFIFFCDAVASWINPKDDLRDMFCKILHGFKNQVGDENWRRFSDQFPLPLKE
Target-Kategorie: TNPO1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:200 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction. Shipping: Ice Bag
Western blot analysis of various lysates using TNPO1 Rabbit pAb (A9435) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 1s.