FTCD Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A9484
Artikelname: FTCD Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A9484
Hersteller Artikelnummer: A9484
Alternativnummer: ABB-A9484-100UL,ABB-A9484-20UL,ABB-A9484-500UL,ABB-A9484-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: LCHC1, FTCD
The protein encoded by this gene is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool. Mutations in this gene are associated with glutamate formiminotransferase deficiency. Alternatively spliced transcript variants have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 59kDa
NCBI: 10841
UniProt: O95954
Reinheit: Affinity purification
Sequenz: DAEAFTAYLEAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE
Target-Kategorie: FTCD
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Endocrine Metabolism,Amino acid metabolism. Shipping: Ice Bag
Western blot analysis of various lysates, using FTCD Rabbit pAb (A9484) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.