FTCD Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A9484
- Bilder (1)
| Artikelname: | FTCD Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A9484 |
| Hersteller Artikelnummer: | A9484 |
| Alternativnummer: | ABB-A9484-100UL,ABB-A9484-20UL,ABB-A9484-500UL,ABB-A9484-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | LCHC1, FTCD |
| The protein encoded by this gene is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool. Mutations in this gene are associated with glutamate formiminotransferase deficiency. Alternatively spliced transcript variants have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 59kDa |
| NCBI: | 10841 |
| UniProt: | O95954 |
| Reinheit: | Affinity purification |
| Sequenz: | DAEAFTAYLEAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE |
| Target-Kategorie: | FTCD |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Endocrine Metabolism,Amino acid metabolism. Shipping: Ice Bag |

