PLA2G6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A9492
Artikelname: PLA2G6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A9492
Hersteller Artikelnummer: A9492
Alternativnummer: ABB-A9492-20UL,ABB-A9492-100UL,ABB-A9492-500UL,ABB-A9492-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: GVI, PLA2, INAD1, NBIA2, iPLA2, NBIA2A, NBIA2B, PARK14, PNPLA9, CaI-PLA2, IPLA2-VIA, iPLA2beta, PLA2G6
The protein encoded by this gene is an A2 phospholipase, a class of enzyme that catalyzes the release of fatty acids from phospholipids. The encoded protein may play a role in phospholipid remodelling, arachidonic acid release, leukotriene and prostaglandin synthesis, fas-mediated apoptosis, and transmembrane ion flux in glucose-stimulated B-cells. Several transcript variants encoding multiple isoforms have been described, but the full-length nature of only three of them have been determined to date.
Klonalität: Polyclonal
Molekulargewicht: 90kDa
NCBI: 8398
UniProt: O60733
Reinheit: Affinity purification
Sequenz: EGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNSQVLQLLGRNAVAGLNQVNNQGLTPLHLACQLGKQEMVRVLLLCNARCNIMG
Target-Kategorie: PLA2G6
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Rat. ResearchArea: Signal Transduction. Shipping: Ice Bag
Western blot analysis of lysates from Rat brain, using PLA2G6 Rabbit pAb (A9492) at 1:1500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.