CHERP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A9702
Artikelname: CHERP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A9702
Hersteller Artikelnummer: A9702
Alternativnummer: ABB-A9702-100UL,ABB-A9702-20UL,ABB-A9702-500UL,ABB-A9702-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: SRA1, DAN16, SCAF6, CHERP
Enables transmembrane transporter binding activity. Involved in positive regulation of calcineurin-NFAT signaling cascade and release of sequestered calcium ion into cytosol. Acts upstream of or within cellular calcium ion homeostasis and negative regulation of cell population proliferation. Located in perinuclear region of cytoplasm.
Klonalität: Polyclonal
Molekulargewicht: 104kDa
NCBI: 10523
UniProt: Q8IWX8
Reinheit: Affinity purification
Sequenz: LPAGLMAPLVKLEDHEYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFFRAKMRARRRKGQEKRNSGPSRSRSRSKSRGRSS
Target-Kategorie: CHERP
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction,Neuroscience,Calcium Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using CHERP Rabbit pAb (A9702) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.