CLNS1A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A9739
- Bilder (1)
| Artikelname: | CLNS1A Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A9739 |
| Hersteller Artikelnummer: | A9739 |
| Alternativnummer: | ABB-A9739-100UL,ABB-A9739-20UL,ABB-A9739-500UL,ABB-A9739-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CLCI, ICln, CLNS1B, CLNS1A |
| This gene encodes a protein that functions in multiple regulatory pathways. The encoded protein complexes with numerous cytosolic proteins and performs diverse functions including regulation of small nuclear ribonucleoprotein biosynthesis, platelet activation and cytoskeletal organization. The protein is also found associated with the plasma membrane where it functions as a chloride current regulator. Pseudogenes of this gene are found on chromosomes 1, 4 and 6. Several transcript variants encoding different isoforms have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 26kDa |
| NCBI: | 1207 |
| UniProt: | P54105 |
| Reinheit: | Affinity purification |
| Sequenz: | MSFLKSFPPPGPAEGLLRQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHALSRDRSDCLGEHLYVMVNAKFEEESKEPVADEEEEDSDDDVEPITEFRFVPSDKSALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH |
| Target-Kategorie: | CLNS1A |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding. Shipping: Ice Bag |

