MTERFD1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A9804
- Bilder (1)
| Artikelname: | MTERFD1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A9804 |
| Hersteller Artikelnummer: | A9804 |
| Alternativnummer: | ABB-A9804-100UL,ABB-A9804-20UL,ABB-A9804-1000UL,ABB-A9804-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CGI-12, MTERFD1 |
| Enables transcription cis-regulatory region binding activity. Involved in negative regulation of transcription, DNA-templated. Located in cytosol and mitochondrion. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 48kDa |
| NCBI: | 51001 |
| UniProt: | Q96E29 |
| Reinheit: | Affinity purification |
| Sequenz: | SSQSTSSSSQENNSAQSSLLPSMNEQSQKTQNISSFDSELFLEELDELPPLSPMQPISEEEAIQIIADPPLPPASFTLRDYVDHSETLQKLVLLGVDLSKIEKHPEAANLLLRLDFEKDIKQMLLFLKDVGIEDNQLGAFLTKNHAIFSEDLENLKTRVAYLHSKNFSKADVAQMVRKAPFLLNFSVERLDNRLGFFQKELELSVKKTRDLVVRLPRLLTGSLEPVKENMKV |
| Target-Kategorie: | MTERF3 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Autophagy,Endocrine Metabolism,Mitochondrial metabolism. Shipping: Ice Bag |

