EPHB2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A9813
- Bilder (1)
| Artikelname: | EPHB2 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A9813 |
| Hersteller Artikelnummer: | A9813 |
| Alternativnummer: | ABB-A9813-20UL,ABB-A9813-100UL,ABB-A9813-500UL,ABB-A9813-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DRT, EK5, ERK, CAPB, Hek5, PCBC, EPHT3, Tyro5, BDPLT22, EPHB2 |
| This gene encodes a member of the Eph receptor family of receptor tyrosine kinase transmembrane glycoproteins. These receptors are composed of an N-terminal glycosylated ligand-binding domain, a transmembrane region and an intracellular kinase domain. They bind ligands called ephrins and are involved in diverse cellular processes including motility, division, and differentiation. A distinguishing characteristic of Eph-ephrin signaling is that both receptors and ligands are competent to transduce a signaling cascade, resulting in bidirectional signaling. This protein belongs to a subgroup of the Eph receptors called EphB. Proteins of this subgroup are distinguished from other members of the family by sequence homology and preferential binding affinity for membrane-bound ephrin-B ligands. Allelic variants are associated with prostate and brain cancer susceptibility. Alternative splicing results in multiple transcript variants. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 117kDa |
| NCBI: | 2048 |
| UniProt: | P29323 |
| Reinheit: | Affinity purification |
| Sequenz: | PIGRCMCKAGFEAVENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIPSAPQAVISSVNETSLMLEWTPPRDSGGREDLVYNIICKSCGSGRGACTRCGDNVQYAPRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPFSPQFASVNITTNQAAPSAVSIMHQVSRTVDSITLSWSQPDQPNGVILDYELQYYEKELSEYNATAIKSPTNTVTVQGLKAGAIY |
| Target-Kategorie: | EPHB2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Signal Transduction,Kinase,Tyrosine kinases,Neuroscience, Cell Type Marker,Cardiovascular,Angiogenesis,Neuron marker. Shipping: Ice Bag |

