GNGT2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A9818
Artikelname: GNGT2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A9818
Hersteller Artikelnummer: A9818
Alternativnummer: ABB-A9818-100UL,ABB-A9818-20UL,ABB-A9818-1000UL,ABB-A9818-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: GNG9, HG3I, GNGT8, G-GAMMA-8, G-GAMMA-C, GNGT2
Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. The encoded protein is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones. Several transcript variants encoding the same protein have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 8kDa
NCBI: 2793
UniProt: O14610
Reinheit: Affinity purification
Sequenz: MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS
Target-Kategorie: GNGT2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Signal Transduction,G protein signaling,Small G proteins,mTOR Signaling Pathway,Neuroscience,Neurodegenerative Diseases,Dopamine Signaling in Parkinsons Disease. Shipping: Ice Bag
Western blot analysis of lysates from Mouse eye, using GNGT2 Rabbit pAb (A9818) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.