GUCA2A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A9820
Artikelname: GUCA2A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A9820
Hersteller Artikelnummer: A9820
Alternativnummer: ABB-A9820-100UL,ABB-A9820-20UL,ABB-A9820-1000UL,ABB-A9820-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: GUCA2, STARA, GCAP-I, GUCA2A
Predicted to enable guanylate cyclase activator activity. Predicted to be involved in positive regulation of guanylate cyclase activity and signal transduction. Predicted to be located in extracellular region.
Klonalität: Polyclonal
Molekulargewicht: 12kDa
NCBI: 2980
UniProt: Q02747
Reinheit: Affinity purification
Sequenz: VTVQDGNFSFSLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC
Target-Kategorie: GUCA2A
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Growth factors,Neuroscience,Calcium Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using GUCA2A Rabbit pAb (A9820) at 1:1000 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25µg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 5s.