HOXA13 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A9822
Artikelname: HOXA13 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A9822
Hersteller Artikelnummer: A9822
Alternativnummer: ABB-A9822-100UL,ABB-A9822-20UL,ABB-A9822-500UL,ABB-A9822-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HOX1, HOX1J, HOXA13
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. Expansion of a polyalanine tract in the encoded protein can cause hand-foot-uterus syndrome, also known as hand-foot-genital syndrome.
Klonalität: Polyclonal
Molekulargewicht: 40kDa
NCBI: 3209
UniProt: P31271
Reinheit: Affinity purification
Sequenz: GPAGPAGAEAAKQCSPCSAAAQSSSGPAALPYGYFGSGYYPCARMGPHPNAIKSCAQPASAAAAAAFADKYMDTAGPAAEEFSSRAKEFAFYHQGYAAGPYHHHQPMPGYLDMPVVPGLGGPGESRHEPLGLPMESYQPWALPNGWNGQMYCPKEQAQPPHLWKSTLPDVVSHPSDASSYR
Target-Kategorie: HOXA13
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:4000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cell Biology Developmental Biology. Shipping: Ice Bag
Western blot analysis of various lysates using HOXA13 Rabbit pAb (A9822) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.