JARID2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A9823
- Bilder (1)
| Artikelname: | JARID2 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A9823 |
| Hersteller Artikelnummer: | A9823 |
| Alternativnummer: | ABB-A9823-20UL,ABB-A9823-100UL,ABB-A9823-1000UL,ABB-A9823-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | JMJ, DIDDF, JARID2 |
| This gene encodes a Jumonji- and AT-rich interaction domain (ARID)-domain-containing protein. The encoded protein is a DNA-binding protein that functions as a transcriptional repressor. This protein interacts with the Polycomb repressive complex 2 (PRC2) which plays an essential role in regulating gene expression during embryonic development. This protein facilitates the recruitment of the PRC2 complex to target genes. Alternate splicing results in multiple transcript variants. Mutations in this gene are associated with chronic myeloid malignancies. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 139kDa |
| NCBI: | 3720 |
| UniProt: | Q92833 |
| Reinheit: | Affinity purification |
| Sequenz: | ETVHFATTQWTSMGFETAKEMKRRHIAKPFSMEKLLYQIAQAEAKKENGPTLSTISALLDELRDTELRQRRQLFEAGLHSSARYGSHDGSSTVADGKKKPRKWLQLETSERRCQICQHLCYLSMVVQENENVVFCLECALRHVEKQKSCRGLKLMYRYDEEQIISLVNQICGKVSGKNGSIENCLSKPTPKRGPRKRATVDVPPSRLSASSSSKSASSSS |
| Target-Kategorie: | JARID2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Neuroscience. Shipping: Ice Bag |

