MYO5A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A9830
- Bilder (1)
| Artikelname: | MYO5A Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A9830 |
| Hersteller Artikelnummer: | A9830 |
| Alternativnummer: | ABB-A9830-20UL,ABB-A9830-100UL,ABB-A9830-500UL,ABB-A9830-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GS1, MYO5, MYH12, MYR12, MYO5A |
| This gene is one of three myosin V heavy-chain genes, belonging to the myosin gene superfamily. Myosin V is a class of actin-based motor proteins involved in cytoplasmic vesicle transport and anchorage, spindle-pole alignment and mRNA translocation. The protein encoded by this gene is abundant in melanocytes and nerve cells. Mutations in this gene cause Griscelli syndrome type-1 (GS1), Griscelli syndrome type-3 (GS3) and neuroectodermal melanolysosomal disease, or Elejalde disease. Multiple alternatively spliced transcript variants encoding different isoforms have been reported, but the full-length nature of some variants has not been determined. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 215kDa |
| NCBI: | 4644 |
| UniProt: | Q9Y4I1 |
| Reinheit: | Affinity purification |
| Sequenz: | LTNLEGIYNSETEKLRSDLERLQLSEEEAKVATGRVLSLQEEIAKLRKDLEQTRSEKKCIEEHADRYKQETEQLVSNLKEENTLLKQEKEALNHRIVQQAKEMTETMEKKLVEETKQLELDLNDERLRYQNLLNEFSRLEERYDDLKEEMTLMVHVPKPGHKRTDSTHSSNESEYIFSSEIAEMEDIPSRTEEPSEKKVPL |
| Target-Kategorie: | MYO5A |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Motor Proteins,Endocrine Metabolism,Mitochondrial metabolism,Neuroscience. Shipping: Ice Bag |

