MAD2B/MAD2L2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A9861
- Bilder (1)
| Artikelname: | MAD2B/MAD2L2 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A9861 |
| Hersteller Artikelnummer: | A9861 |
| Alternativnummer: | ABB-A9861-100UL,ABB-A9861-20UL,ABB-A9861-1000UL,ABB-A9861-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | REV7, FANCV, MAD2B, POLZ2, MAD2B/MAD2L2 |
| The protein encoded by this gene is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. The encoded protein, which is similar to MAD2L1, is capable of interacting with ADAM9, ADAM15, REV1, and REV3 proteins. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 24kDa |
| NCBI: | 10459 |
| UniProt: | Q9UI95 |
| Reinheit: | Affinity purification |
| Sequenz: | MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKGS |
| Target-Kategorie: | MAD2L2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Cell Biology Developmental Biology,Cell Cycle. Shipping: Ice Bag |

