ZFPM2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A9868
- Bilder (1)
| Artikelname: | ZFPM2 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A9868 |
| Hersteller Artikelnummer: | A9868 |
| Alternativnummer: | ABB-A9868-100UL,ABB-A9868-20UL,ABB-A9868-1000UL,ABB-A9868-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DIH3, FOG2, SRXY9, ZNF89B, hFOG-2, ZC2HC11B, ZFPM2 |
| The zinc finger protein encoded by this gene is a widely expressed member of the FOG family of transcription factors. The family members modulate the activity of GATA family proteins, which are important regulators of hematopoiesis and cardiogenesis in mammals. It has been demonstrated that the protein can both activate and down-regulate expression of GATA-target genes, suggesting different modulation in different promoter contexts. A related mRNA suggests an alternatively spliced product but this information is not yet fully supported by the sequence. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 128kDa |
| NCBI: | 23414 |
| UniProt: | Q8WW38 |
| Reinheit: | Affinity purification |
| Sequenz: | SPYYGIKPSDYISGSLVIHNTDIEQSRNAENESPKGQASSNGCAALKKDSLPLLPKNRGMVIVNGGLKQDERPAANPQQENISQNPQHEDDHKSPSWISENPLAANENVSPGIPSAEEQLSSIAKGVNGSSQAPTSGKYCRLCDIQFNNLSNFITHKKFYCSSHAAEHVK |
| Target-Kategorie: | ZFPM2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Neuroscience,Cardiovascular,Heart,Cardiogenesis. Shipping: Ice Bag |

