RBM15B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A9873
- Bilder (1)
| Artikelname: | RBM15B Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A9873 |
| Hersteller Artikelnummer: | A9873 |
| Alternativnummer: | ABB-A9873-20UL,ABB-A9873-100UL,ABB-A9873-500UL,ABB-A9873-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | OTT3, HsOTT3, HUMAGCGB, RBM15B |
| Members of the SPEN (Split-end) family of proteins, including RBM15B, have repressor function in several signaling pathways and may bind to RNA through interaction with spliceosome components (Hiriart et al., 2005 [PubMed 16129689]). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 97kDa |
| NCBI: | 29890 |
| UniProt: | Q8NDT2 |
| Reinheit: | Affinity purification |
| Sequenz: | DRDRTFLEGDWTSPSKSSDRRNSLEGYSRSVRSRSGERWGADGDRGLPKPWEERRKRRSLSSDRGRTTHSPYEERSRTKGSGQQSERGSDRTPERSRKENHSSEGTKESSSNSLSNSRHGAEERGHHHHHHEAADSSHGKKARDSERNHRTTEAEPKPLEEPKHETKKLKNLSEYAQTLQL |
| Target-Kategorie: | RBM15B |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction. Shipping: Ice Bag |

