ROBO4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A9876
Artikelname: ROBO4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A9876
Hersteller Artikelnummer: A9876
Alternativnummer: ABB-A9876-100UL,ABB-A9876-20UL,ABB-A9876-500UL,ABB-A9876-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: MRB, AOVD3, ECSM4, ROBO4
Predicted to enable cell-cell adhesion mediator activity. Involved in angiogenesis and establishment of endothelial barrier. Located in extracellular exosome. Implicated in aortic valve disease 3.
Klonalität: Polyclonal
Molekulargewicht: 107kDa
NCBI: 54538
UniProt: Q8WZ75
Reinheit: Affinity purification
Sequenz: GVGPKGGVLLCPPRPCLTPTPSEGSLANGWGSASEDNAASARASLVSSSDGSFLADAHFARALAVAVDSFGFGLEPREADCVFIDASSPPSPRDEIFLTPNLSLPLWEWRPDWLEDMEVSHTQRLGRGMPPWPPDSQISSQRSQLHCRMPKAGASPVDYS
Target-Kategorie: ROBO4
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Cancer,Invasion and Metastasis,Cell Biology Developmental Biology,Extracellular Matrix,Neuroscience,Cardiovascular,Angiogenesis. Shipping: Ice Bag
Western blot analysis of various lysates using ROBO4 Rabbit pAb (A9876) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.