HSP20/HSPB6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A9887
- Bilder (1)
| Artikelname: | HSP20/HSPB6 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A9887 |
| Hersteller Artikelnummer: | A9887 |
| Alternativnummer: | ABB-A9887-100UL,ABB-A9887-20UL,ABB-A9887-500UL,ABB-A9887-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HEL55, Hsp20, PPP1R91, HSP20/HSPB6 |
| This locus encodes a heat shock protein. The encoded protein likely plays a role in smooth muscle relaxation. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 17kDa |
| NCBI: | 126393 |
| UniProt: | O14558 |
| Reinheit: | Affinity purification |
| Sequenz: | MEIPVPVQPSWLRRASAPLPGLSAPGRLFDQRFGEGLLEAELAALCPTTLAPYYLRAPSVALPVAQVPTDPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPASAQAPPPAAAK |
| Target-Kategorie: | HSPB6 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse. ResearchArea: Apoptosis,Cardiovascular,Heart. Shipping: Ice Bag |

