NODAL Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A9902
Artikelname: NODAL Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A9902
Hersteller Artikelnummer: A9902
Alternativnummer: ABB-A9902-100UL,ABB-A9902-20UL,ABB-A9902-1000UL,ABB-A9902-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HTX5, NODAL
This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate the mature protein, which regulates early embryonic development. This protein is required for maintenance of human embryonic stem cell pluripotency and may play a role in human placental development. Mutations in this gene are associated with heterotaxy, a condition characterized by random orientation of visceral organs with respect to the left-right axis.
Klonalität: Polyclonal
Molekulargewicht: 40kDa
NCBI: 4838
UniProt: Q96S42
Reinheit: Affinity purification
Sequenz: SNLSQEQRQLGGSTLLWEAESSWRAQEGQLSWEWGKRHRRHHLPDRSQLCRKVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGCL
Target-Kategorie: NODAL
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Rat. ResearchArea: Cell Biology Developmental Biology,Growth factors,TGF-b-Smad Signaling Pathway,ESC Pluripotency and Differentiation,Immunology Inflammation,Cytokines,Stem Cells,Embryonic Stem Cells. Shipping: Ice Bag
Western blot analysis of various lysates using NODAL Rabbit pAb (A9902) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.