KCNJ6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A9935
Artikelname: KCNJ6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A9935
Hersteller Artikelnummer: A9935
Alternativnummer: ABB-A9935-100UL,ABB-A9935-20UL,ABB-A9935-1000UL,ABB-A9935-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: BIR1, GIRK2, KATP2, KCNJ7, KPLBS, GIRK-2, KATP-2, KIR3.2, hiGIRK2, KCNJ6
This gene encodes a member of the G protein-coupled inwardly-rectifying potassium channel family of inward rectifier potassium channels. This type of potassium channel allows a greater flow of potassium into the cell than out of it. These proteins modulate many physiological processes, including heart rate in cardiac cells and circuit activity in neuronal cells, through G-protein coupled receptor stimulation. Mutations in this gene are associated with Keppen-Lubinsky Syndrome, a rare condition characterized by severe developmental delay, facial dysmorphism, and intellectual disability.
Klonalität: Polyclonal
Molekulargewicht: 48kDa
NCBI: 3763
UniProt: P48051
Reinheit: Affinity purification
Sequenz: MAKLTESMTNVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHISRDRTKRKIQRYVRKDGKCNVHHGNVRETYRYLTDI
Target-Kategorie: KCNJ6
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Neuroscience, Cell Type Marker,Neuron marker. Shipping: Ice Bag
Western blot analysis of lysates from wild type (WT) and 293T cells transfected with KCNJ6 using KCNJ6 Rabbit pAb (A9935) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.