SAE1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A9960
- Bilder (1)
| Artikelname: | SAE1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A9960 |
| Hersteller Artikelnummer: | A9960 |
| Alternativnummer: | ABB-A9960-100UL,ABB-A9960-20UL,ABB-A9960-1000UL,ABB-A9960-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | AOS1, SUA1, UBLE1A, HSPC140, SAE1 |
| Posttranslational modification of proteins by the addition of the small protein SUMO (see SUMO1, MIM 601912), or sumoylation, regulates protein structure and intracellular localization. SAE1 and UBA2 (MIM 613295) form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins (Okuma et al., 1999 [PubMed 9920803]). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 38kDa |
| NCBI: | 10055 |
| UniProt: | Q9UBE0 |
| Reinheit: | Affinity purification |
| Sequenz: | MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGR |
| Target-Kategorie: | SAE1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway. Shipping: Ice Bag |

