MZT2B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A9984
- Bilder (1)
| Artikelname: | MZT2B Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A9984 |
| Hersteller Artikelnummer: | A9984 |
| Alternativnummer: | ABB-A9984-100UL,ABB-A9984-20UL,ABB-A9984-500UL,ABB-A9984-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FAM128B, MOZART2B, MZT2B |
| Located in cytosol, microtubule cytoskeleton, and nucleoplasm. Part of gamma-tubulin large complex. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 16kDa |
| NCBI: | 80097 |
| UniProt: | Q6NZ67 |
| Reinheit: | Affinity purification |
| Sequenz: | MAAQGVGPGPGSAAPPGLEAARQKLALRRKKVLSTEEMELYELAQAAGGAIDPDVFKILVDLLKLNVAPLAVFQMLKSMCAGQRLASEPQDPAAVSLPTSSVPETRGRNKGSAALGGALALAERSSREGSSQRMPRQPSATRLPKGGGPGKSPTRGST |
| Target-Kategorie: | MZT2B |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Cell Biology Developmental Biology,Cell Cycle,Centrosome. Shipping: Ice Bag |

