MZT2B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A9984
Artikelname: MZT2B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A9984
Hersteller Artikelnummer: A9984
Alternativnummer: ABB-A9984-100UL,ABB-A9984-20UL,ABB-A9984-500UL,ABB-A9984-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: FAM128B, MOZART2B, MZT2B
Located in cytosol, microtubule cytoskeleton, and nucleoplasm. Part of gamma-tubulin large complex.
Klonalität: Polyclonal
Molekulargewicht: 16kDa
NCBI: 80097
UniProt: Q6NZ67
Reinheit: Affinity purification
Sequenz: MAAQGVGPGPGSAAPPGLEAARQKLALRRKKVLSTEEMELYELAQAAGGAIDPDVFKILVDLLKLNVAPLAVFQMLKSMCAGQRLASEPQDPAAVSLPTSSVPETRGRNKGSAALGGALALAERSSREGSSQRMPRQPSATRLPKGGGPGKSPTRGST
Target-Kategorie: MZT2B
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Cell Biology Developmental Biology,Cell Cycle,Centrosome. Shipping: Ice Bag
Western blot analysis of various lysates using MZT2B Rabbit pAb (A9984) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.