SLC2A13 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A9993
Artikelname: SLC2A13 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A9993
Hersteller Artikelnummer: A9993
Alternativnummer: ABB-A9993-100UL,ABB-A9993-20UL,ABB-A9993-1000UL,ABB-A9993-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HMIT, SLC2A13
Enables ATPase binding activity, myo-inositol:proton symporter activity, and protease binding activity. Involved in myo-inositol transport and positive regulation of amyloid-beta formation. Is integral component of plasma membrane. Part of cell body, cell periphery, and cell projection.
Klonalität: Polyclonal
Molekulargewicht: 70kDa
NCBI: 114134
UniProt: Q96QE2
Reinheit: Affinity purification
Sequenz: LHTAEYLTYYGAFFLYAGFAAVGLLFIYGCLPETKGKKLEEIESLFDNRLCTCGTSDSDEGRYIEYIRVKGSNYHLSDNDASDVE
Target-Kategorie: SLC2A13
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:4000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Endocrine Metabolism,Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease. Shipping: Ice Bag
Western blot analysis of various lysates using SLC2A13 Rabbit pAb (A9993) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.