beta-Actin Rabbit pAb, Unconjugated

Artikelnummer: ABB-AC006
Artikelname: beta-Actin Rabbit pAb, Unconjugated
Artikelnummer: ABB-AC006
Hersteller Artikelnummer: AC006
Alternativnummer: ABB-AC006-200UL,ABB-AC006-100UL,ABB-AC006-50UL,ABB-AC006-500UL,ABB-AC006-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: BRWS1, PS1TP5BP1, beta-Actin
This gene encodes one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, integrity, and intercellular signaling. The encoded protein is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins that are ubiquitously expressed. Mutations in this gene cause Baraitser-Winter syndrome 1, which is characterized by intellectual disability with a distinctive facial appearance in human patients. Numerous pseudogenes of this gene have been identified throughout the human genome.
Klonalität: Polyclonal
Konzentration: WB
Molekulargewicht: 42 kDa
NCBI: 60
UniProt: P60709
Reinheit: Affinity purification
Sequenz: MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERF
Target-Kategorie: ACTB
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:10000 - 1:100000
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Microfilaments,Death Receptor Signaling Pathway,Endocrine Metabolism,Mitochondrial metabolism,Immunology Inflammation. Shipping: Ice Bag
Western blot analysis of various lysates using beta-Actin Rabbit pAb (AC006) at 1:125000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30 s.