beta-Actin Rabbit pAb, Unconjugated
Artikelnummer:
ABB-AC006
- Bilder (1)
| Artikelname: | beta-Actin Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-AC006 |
| Hersteller Artikelnummer: | AC006 |
| Alternativnummer: | ABB-AC006-200UL,ABB-AC006-100UL,ABB-AC006-50UL,ABB-AC006-500UL,ABB-AC006-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BRWS1, PS1TP5BP1, beta-Actin |
| This gene encodes one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, integrity, and intercellular signaling. The encoded protein is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins that are ubiquitously expressed. Mutations in this gene cause Baraitser-Winter syndrome 1, which is characterized by intellectual disability with a distinctive facial appearance in human patients. Numerous pseudogenes of this gene have been identified throughout the human genome. |
| Klonalität: | Polyclonal |
| Konzentration: | WB |
| Molekulargewicht: | 42 kDa |
| NCBI: | 60 |
| UniProt: | P60709 |
| Reinheit: | Affinity purification |
| Sequenz: | MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERF |
| Target-Kategorie: | ACTB |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:10000 - 1:100000 |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Microfilaments,Death Receptor Signaling Pathway,Endocrine Metabolism,Mitochondrial metabolism,Immunology Inflammation. Shipping: Ice Bag |

