Recombinant Human beta Defensin 3/DEFB103A Protein

Artikelnummer: ABB-RP02867
Artikelname: Recombinant Human beta Defensin 3/DEFB103A Protein
Artikelnummer: ABB-RP02867
Hersteller Artikelnummer: RP02867
Alternativnummer: ABB-RP02867-100UG
Hersteller: ABclonal
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Gly23-Lys67
Alternative Synonym: Beta-defensin 3, BD-3, DEFB-3, HBD3, hBD-3,DEFB103A
Recombinant Human beta Defensin 3/DEFB103A Protein is produced by E. coli expression system. The target protein is expressed with sequence (Gly23-Lys67) of human beta Defensin 3/DEFB103A (Accession NP_061131.1) fused with a 6*His tag at the N-terminus.
Konzentration: Please contact us for more information.
Molekulargewicht: 7.3 kDa
Tag: N-His
NCBI: 55894
UniProt: P81534
Quelle: E. coli
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of 50mM Tris, 0.3% Ttiton X-100, 0.3% SKL, pH 8.5.
Sequenz: GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
Target-Kategorie: beta Defensin 3/DEFB103A
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of 50mM Tris, 0.3% Ttiton X-100, 0.3% SKL, pH 8.5.
Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein. Shipping: Ice Bag
Recombinant Human beta Defensin 3/DEFB103A Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.