Recombinant Mouse Cathepsin B Protein

Artikelnummer: ABB-RP02994
Artikelname: Recombinant Mouse Cathepsin B Protein
Artikelnummer: ABB-RP02994
Hersteller Artikelnummer: RP02994
Alternativnummer: ABB-RP02994-50UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Immunogen: His18-Phe339
Alternative Synonym: Cathepsin B, 3.4.22.1, APP secretase, APPS, Cathepsin B1,CTSB
Recombinant Mouse Cathepsin B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His18-Phe339) of mouse Cathepsin B (Accession NP_031824.1) fused with a 6*His tag at the C-terminus.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 36.6 kDa
Tag: C-His
NCBI: 13030
UniProt: P10605
Quelle: HEK293 cells
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequenz: HDKPSFHPLSDDLINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPKLPGRVAFGEDIDLPETFDAREQWSNCPTIGQIRDQGSCGSCWAFGAVEAISDRTCIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWSFWTKKGLVSGGVYNSHVGCLPYTIPPCEHHVNGSRPPCTGEGDTPRCNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAG
Target-Kategorie: Cathepsin B
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein. Shipping: Ice Bag
Recombinant Mouse Cathepsin B Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.