Recombinant Human EBP1 Protein

Artikelnummer: ABB-RP03200
Artikelname: Recombinant Human EBP1 Protein
Artikelnummer: ABB-RP03200
Hersteller Artikelnummer: RP03200
Alternativnummer: ABB-RP03200-100UG
Hersteller: ABclonal
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Ser2-Asp394
Alternative Synonym: EBP1, HG4-1, p38-2G4, PA2G4
Recombinant Human EBP1 Protein is produced by E.coli expression system. The target protein is expressed with sequence (Ser2-Asp394) of human EBP1 (Accession Q9UQ80) fused with His tag at the N-terminus.
Konzentration: Please contact us for more information.
Molekulargewicht: 45.2 kDa
Tag: N-His
NCBI: 5036
UniProt: Q9UQ80
Quelle: E.coli
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from sterile 20 mM Tris, 0.5 M NaCl, pH 8.0. Please contact us for any concerns or special requirements. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Sequenz: SGEDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKKEKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVVDVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQRTTIYKRDPSKQYG
Target-Kategorie: PA2G4
Application Verdünnung: Lyophilized from sterile 20 mM Tris, 0.5 M NaCl, pH 8.0. Please contact us for any concerns or special requirements. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Anwendungsbeschreibung: ResearchArea: Other Recombinant Protein. Shipping: Ice Bag
Recombinant Human EBP1 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.